Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial

Product Description

Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial is available at Gentaur for Next week Delivery.

Gene Name: MFSD8

Alternative Names : Ceroid-lipofuscinosis neuronal protein 7

Expression Region : 1-40aa

AA Sequence : MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-GST-tagged

Theoretical MW : 34.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be a carrier that transport small solutes by using chemiosmotic ion gradients

Function : May be a carrier that transport small solutes by using chemiosmotic ion gradients.

Involvement in disease : Ceroid lipofuscinosis, neuronal, 7 (CLN7); Macular dystrophy with central cone involvement (CCMD)

Subcellular location : Lysosome membrane, Multi-pass membrane protein

Protein Families : Major facilitator superfamily

Tissue Specificity : Expressed at very low levels in all tissues tested.

Paythway :

Uniprot ID : Q8NHS3