Product Description
Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial is available at Gentaur for Next week Delivery.
Gene Name: MFSD8
Alternative Names : Ceroid-lipofuscinosis neuronal protein 7
Expression Region : 1-40aa
AA Sequence : MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
Sequence Info : Partial
Tag Info : N-terminal 6xHis-GST-tagged
Theoretical MW : 34.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be a carrier that transport small solutes by using chemiosmotic ion gradients
Function : May be a carrier that transport small solutes by using chemiosmotic ion gradients.
Involvement in disease : Ceroid lipofuscinosis, neuronal, 7 (CLN7); Macular dystrophy with central cone involvement (CCMD)
Subcellular location : Lysosome membrane, Multi-pass membrane protein
Protein Families : Major facilitator superfamily
Tissue Specificity : Expressed at very low levels in all tissues tested.
Paythway :
Uniprot ID : Q8NHS3
Euro
British Pound
US Dollar