Recombinant Human Matrilysin (MMP7)

Product Description

Recombinant Human Matrilysin (MMP7) is available at Gentaur for Next week Delivery.

Gene Name: MMP7

Alternative Names : Matrin;Matrix metalloproteinase-7;MMP-7Pump-1 proteaseUterine metalloproteinase

Expression Region : 95-267aa

AA Sequence : YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Function : Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Peptidase M10A family

Tissue Specificity :

Paythway : Wntsignalingpathway

Uniprot ID : P09237