Recombinant Human Melanoma-associated antigen 10 (MAGEA10)

Product Description

Recombinant Human Melanoma-associated antigen 10 (MAGEA10) is available at Gentaur for Next week Delivery.

Gene Name: MAGEA10

Alternative Names : Cancer/testis antigen 1.10

Expression Region : 1-369aa

AA Sequence : MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 42.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Function : Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Involvement in disease :

Subcellular location : Nucleus

Protein Families :

Tissue Specificity : Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.

Paythway :

Uniprot ID : P43363