Product Description
Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial is available at Gentaur for Next week Delivery.
Gene Name: TIMP3
Alternative Names : Protein MIG-5Tissue inhibitor of metalloproteinases 3;TIMP-3
Expression Region : 30-208aa
AA Sequence : HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 24.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Function : Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Involvement in disease : Sorsby fundus dystrophy (SFD)
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families : Protease inhibitor I35 (TIMP) family
Tissue Specificity :
Paythway :
Uniprot ID : P35625
Euro
British Pound
US Dollar