Product Description
Recombinant Human Metalloproteinase inhibitor 4 (TIMP4), partial is available at Gentaur for Next week Delivery.
Gene Name: TIMP4
Alternative Names : Tissue inhibitor of metalloproteinases 4;TIMP-4
Expression Region : 31-224aa
AA Sequence : SCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 26.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Function : Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Protease inhibitor I35 (TIMP) family
Tissue Specificity : Abundant in heart and present at low levels in many other tissues.
Paythway :
Uniprot ID : Q99727
Euro
British Pound
US Dollar