Product Description
Recombinant Human Metalloreductase STEAP1 (STEAP1), partial is available at Gentaur for Next week Delivery.
Gene Name: STEAP1
Alternative Names : Six-transmembrane epithelial antigen of prostate 1
Expression Region : 3-69aa
AA Sequence : SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 35 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor .
Function : Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity).
Involvement in disease :
Subcellular location : Endosome membrane, Multi-pass membrane protein
Protein Families : STEAP family
Tissue Specificity : Ubiquitously expressed. Highly expressed in prostate tumors.
Paythway :
Uniprot ID : Q9UHE8