Product Description
Recombinant Human Metallothionein-1G (MT1G), partial is available at Gentaur for Next week Delivery.
Gene Name: MT1G
Alternative Names : Metallothionein-1K;MT-1KMetallothionein-IG;MT-IG
Expression Region : 1-59aa
AA Sequence : MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
Sequence Info : Partial of Isoform 2
Tag Info : N-terminal GST-tagged
Theoretical MW : 32.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Function : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Involvement in disease :
Subcellular location :
Protein Families : Metallothionein superfamily, Type 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P13640
Euro
British Pound
US Dollar