Euro
British Pound
US Dollar
Product Description
Recombinant Human Metallothionein-1X (MT1X), partial is available at Gentaur for Next week Delivery.
Gene Name: MT1X
Alternative Names : Metallothionein-IX;MT-IX
Expression Region : 1-59aa
AA Sequence : MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 32.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Function : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling
Involvement in disease :
Subcellular location :
Protein Families : Metallothionein superfamily, Type 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P80297
