Recombinant Human Metallothionein-2 (MT2A), partial

Product Description

Recombinant Human Metallothionein-2 (MT2A), partial is available at Gentaur for Next week Delivery.

Gene Name: MT2A

Alternative Names : Metallothionein-2AMetallothionein-II;MT-II

Expression Region : 1-59aa

AA Sequence : MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 7.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Function : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Involvement in disease :

Subcellular location :

Protein Families : Metallothionein superfamily, Type 1 family

Tissue Specificity :

Paythway :

Uniprot ID : P02795