Recombinant Human Metallothionein-3 (MT3)

Product Description

Recombinant Human Metallothionein-3 (MT3) is available at Gentaur for Next week Delivery.

Gene Name: MT3

Alternative Names : GIFB

Expression Region : 1-68aa

AA Sequence : MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 33.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Function : Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Involvement in disease :

Subcellular location :

Protein Families : Metallothionein superfamily, Type 1 family

Tissue Specificity : Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.

Paythway :

Uniprot ID : P25713