Product Description
Recombinant Human Metallothionein-4 (MT4) is available at Gentaur for Next week Delivery.
Gene Name: MT4
Alternative Names : Metallothionein-IV
Expression Region : 1-62aa
AA Sequence : MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 22.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Function : Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Involvement in disease :
Subcellular location :
Protein Families : Metallothionein superfamily, Type 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P47944
Euro
British Pound
US Dollar