Recombinant Human Metallothionein-4 (MT4)

Product Description

Recombinant Human Metallothionein-4 (MT4) is available at Gentaur for Next week Delivery.

Gene Name: MT4

Alternative Names : Metallothionein-IV

Expression Region : 1-62aa

AA Sequence : MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 22.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.

Function : Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.

Involvement in disease :

Subcellular location :

Protein Families : Metallothionein superfamily, Type 1 family

Tissue Specificity :

Paythway :

Uniprot ID : P47944