Recombinant Human Microfibrillar-associated protein 5 (MFAP5)

Product Description

Recombinant Human Microfibrillar-associated protein 5 (MFAP5) is available at Gentaur for Next week Delivery.

Gene Name: MFAP5

Alternative Names : MP25Microfibril-associated glycoprotein 2;MAGP-2

Expression Region : 22-173aa

AA Sequence : IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in hatopoiesis. In the cardiovascular syst, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity . Component of the elastin-associated microfibrils .

Function : May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils

Involvement in disease : Aortic aneurysm, familial thoracic 9 (AAT9)

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : MFAP family

Tissue Specificity :

Paythway :

Uniprot ID : Q13361