Product Description
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B (TIMM10B) is available at Gentaur for Next week Delivery.
Gene Name: TIMM10B
Alternative Names : Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B;Tim10b
Expression Region : 1-103aa
AA Sequence : MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 27.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmbrane proteins into the mitochondrial inner mbrane. The TIM22 complex forms a twin-pore translocase that uses the mbrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70KDA complex that guides the target proteins in transit through the aqueous mitochondrial intermbrane space.
Function : Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Involvement in disease :
Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein
Protein Families : Small Tim family
Tissue Specificity : Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
Paythway :
Uniprot ID : Q9Y5J6
Euro
British Pound
US Dollar