Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19)

Product Description

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) is available at Gentaur for Next week Delivery.

Gene Name: DNAJC19

Alternative Names : DnaJ homolog subfamily C member 19

Expression Region : 1-116aa

AA Sequence : ASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity

Function : Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).

Involvement in disease : 3-methylglutaconic aciduria 5 (MGA5)

Subcellular location : Mitochondrion inner membrane, Single-pass membrane protein

Protein Families : TIM14 family

Tissue Specificity : Ubiquitously expressed.

Paythway :

Uniprot ID : Q96DA6