Recombinant Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16)

Product Description

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) is available at Gentaur for Next week Delivery.

Gene Name: PAM16

Alternative Names : Mitochondria-associated granulocyte macrophage CSF-signaling moleculePresequence translocated-associated motor subunit PAM16

Expression Region : 1-125aa

AA Sequence : MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Function : Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Involvement in disease : Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM)

Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families : TIM16/PAM16 family

Tissue Specificity : Ubiquitously expressed.

Paythway :

Uniprot ID : Q9Y3D7