Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B)

Product Description

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) is available at Gentaur for Next week Delivery.

Gene Name: TIMM17B

Alternative Names :

Expression Region : 1-172aa

AA Sequence : MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Function : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Tim17/Tim22/Tim23 family

Tissue Specificity : Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.

Paythway :

Uniprot ID : O60830