Product Description
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) is available at Gentaur for Next week Delivery.
Gene Name: TIMM17B
Alternative Names :
Expression Region : 1-172aa
AA Sequence : MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 45.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Function : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Involvement in disease :
Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families : Tim17/Tim22/Tim23 family
Tissue Specificity : Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.
Paythway :
Uniprot ID : O60830
Euro
British Pound
US Dollar