Recombinant Human Mitochondrial ornithine transporter 1 (SLC25A15)

Product Description

Recombinant Human Mitochondrial ornithine transporter 1 (SLC25A15) is available at Gentaur for Next week Delivery.

Gene Name: SLC25A15

Alternative Names : Solute carrier family 25 member 15

Expression Region : 1-301aa

AA Sequence : MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 59.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.

Function : Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.

Involvement in disease : Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity : Highly expressed in liver, pancreas, testis, lung and small intestine. Lower levels are detected in spleen, kidney, brain and heart.

Paythway :

Uniprot ID : Q9Y619