Recombinant Human mRNA export factor (RAE1)

Product Description

Recombinant Human mRNA export factor (RAE1) is available at Gentaur for Next week Delivery.

Gene Name: RAE1

Alternative Names : Rae1 protein homolog mRNA-associated protein mrnp 41

Expression Region : 1-368aa

AA Sequence : MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 68 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Function : Plays a role in mitotic bipolar spindle formation

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, spindle pole

Protein Families : WD repeat rae1 family

Tissue Specificity :

Paythway :

Uniprot ID : P78406