Recombinant Human Multidrug resistance protein 1 (ABCB1), partial

Product Description

Recombinant Human Multidrug resistance protein 1 (ABCB1), partial is available at Gentaur for Next week Delivery.

Gene Name: ABCB1

Alternative Names : ATP-binding cassette sub-family B member 1;P-glycoprotein 1; CD243

Expression Region : 236-297aa

AA Sequence : LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 10.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Function : Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Involvement in disease : Inflammatory bowel disease 13 (IBD13)

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily

Tissue Specificity : Expressed in liver, kidney, small intestine and brain.

Paythway :

Uniprot ID : P08183