Recombinant Human Myelin expression factor 2 (MYEF2), partial

Product Description

Recombinant Human Myelin expression factor 2 (MYEF2), partial is available at Gentaur for Next week Delivery.

Gene Name: MYEF2

Alternative Names : MST156

Expression Region : 372-576aa

AA Sequence : GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 37.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 elent 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA .

Function : Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA (By similarity).

Involvement in disease :

Subcellular location : Nucleus

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9P2K5