Recombinant Human Myelin protein P0 (MPZ), partial

Product Description

Recombinant Human Myelin protein P0 (MPZ), partial is available at Gentaur for Next week Delivery.

Gene Name: MPZ

Alternative Names : Myelin peripheral protein;MPPMyelin protein zero

Expression Region : 30-156aa

AA Sequence : IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Creation of an Extracellular domain mbrane face which guides the wrapping process and ultimately compacts adjacent lamellae.

Function : Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.

Involvement in disease : Charcot-Marie-Tooth disease 1B (CMT1B); Charcot-Marie-Tooth disease 2I (CMT2I); Charcot-Marie-Tooth disease 2J (CMT2J); Adie pupil (ADIEP); Charcot-Marie-Tooth disease, dominant, intermediate type, D (CMTDID); Dejerine-Sottas syndrome (DSS); Neuropathy, congenital hypomyelinating or amyelinating (CHN); Roussy-Levy syndrome (ROULS)

Subcellular location : Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform L-MPZ: Myelin membrane, Single-pass type I membrane protein

Protein Families : Myelin P0 protein family

Tissue Specificity : Found only in peripheral nervous system Schwann cells.

Paythway :

Uniprot ID : P25189