Recombinant Human Myomegalin (PDE4DIP)

Product Description

Recombinant Human Myomegalin (PDE4DIP) is available at Gentaur for Next week Delivery.

Gene Name: PDE4DIP

Alternative Names : Cardiomyopathy-associated protein 2 Phosphodiesterase 4D-interacting protein

Expression Region : 1-310aa

AA Sequence : MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK

Sequence Info : Full Length of Isoform 8

Tag Info : N-terminal GST-tagged

Theoretical MW : 63.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May function as an anchor sequestering components of the cAMP-dependent pathway to Golgi and/or centrosomes.

Function : Functions as an anchor sequestering components of the cAMP-dependent pathway to Golgi and/or centrosomes (By similarity). Forms a complex with AKAP9

Involvement in disease : A chromosomal aberration involving PDE4DIP may be the cause of a myeloproliferative disorder (MBD) associated with eosinophilia. Translocation t(1;5)(q23;q33) that forms a PDE4DIP-PDGFRB fusion protein.

Subcellular location : Golgi apparatus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families :

Tissue Specificity : Highly expressed in adult and fetal heart, in skeletal muscle and, to a lower extent, in brain and placenta.

Paythway :

Uniprot ID : Q5VU43