Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1)

Product Description

Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) is available at Gentaur for Next week Delivery.

Gene Name: MYL1

Alternative Names : Myosin light chain alkali 1/2

Expression Region : 1-150aa

AA Sequence : MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Sequence Info : Full Length of Isoform MLC3

Tag Info : N-terminal GST-tagged

Theoretical MW : 43.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulatory light chain of myosin. Does not bind calcium.

Function : Regulatory light chain of myosin. Does not bind calcium.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P05976