Recombinant Human Myosin light polypeptide 6 (MYL6), partial

Product Description

Recombinant Human Myosin light polypeptide 6 (MYL6), partial is available at Gentaur for Next week Delivery.

Gene Name: MYL6

Alternative Names : 17KDA myosin light chain;LC17Myosin light chain 3;MLC-3Myosin light chain alkali 3;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6

Expression Region : 3-151aa

AA Sequence : DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 43.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulatory light chain of myosin. Does not bind calcium.

Function : Regulatory light chain of myosin. Does not bind calcium.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway : Vascularsmoothmusclecontraction

Uniprot ID : P60660