Euro
British Pound
US Dollar
Product Description
Recombinant Human Myosin regulatory light chain 2, atrial isoform (MYL7) is available at Gentaur for Next week Delivery.
Gene Name: MYL7
Alternative Names : Myosin regulatory light chain 7
Expression Region : 1-175aa
AA Sequence : MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 46.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : Predominantly expressed in adult atrial muscle.
Paythway : Focaladhesion
Uniprot ID : Q01449
