Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform (MYLPF)

Product Description

Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform (MYLPF) is available at Gentaur for Next week Delivery.

Gene Name: MYLPF

Alternative Names : Fast skeletal myosin light chain 2MLC2B

Expression Region : 2-169aa

AA Sequence : APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Expressed in fetal and adult skeletal muscle.

Paythway : Focaladhesion

Uniprot ID : Q96A32