Euro
British Pound
US Dollar
Product Description
Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial is available at Gentaur for Next week Delivery.
Gene Name: MYL2
Alternative Names :
Expression Region : 8-164aa
AA Sequence : KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 21.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).
Involvement in disease : Cardiomyopathy, familial hypertrophic 10 (CMH10)
Subcellular location : Cytoplasm, myofibril, sarcomere, A band
Protein Families :
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : P10916
