Recombinant Human N (4)- (beta-N-acetylglucosaminyl)-L-asparaginase (AGA), partial

Product Description

Recombinant Human N (4)- (beta-N-acetylglucosaminyl)-L-asparaginase (AGA), partial is available at Gentaur for Next week Delivery.

Gene Name: AGA

Alternative Names : Aspartylglucosaminidase;Glycosylasparaginase;N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

Expression Region : 206-346aa

AA Sequence : TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 31.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.

Function : Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.

Involvement in disease : Aspartylglucosaminuria (AGU)

Subcellular location : Lysosome

Protein Families : Ntn-hydrolase family

Tissue Specificity :

Paythway :

Uniprot ID : P20933