Product Description
Recombinant Human N-alpha-acetyltransferase 50 (NAA50) is available at Gentaur for Next week Delivery.
Gene Name: NAA50
Alternative Names : N-acetyltransferase 13 N-acetyltransferase 5
Expression Region : 1-169aa
AA Sequence : MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 46.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Probable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.
Function : N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine
Involvement in disease :
Subcellular location : Cytoplasm, Nucleus
Protein Families : Acetyltransferase family, GNAT subfamily
Tissue Specificity :
Paythway :
Uniprot ID : Q9GZZ1
Euro
British Pound
US Dollar