Recombinant Human N-alpha-acetyltransferase 50 (NAA50)

Product Description

Recombinant Human N-alpha-acetyltransferase 50 (NAA50) is available at Gentaur for Next week Delivery.

Gene Name: NAA50

Alternative Names : N-acetyltransferase 13 N-acetyltransferase 5

Expression Region : 1-169aa

AA Sequence : MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.

Function : N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : Acetyltransferase family, GNAT subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q9GZZ1