Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (NDUFA6), partial

Product Description

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (NDUFA6), partial is available at Gentaur for Next week Delivery.

Gene Name: NDUFA6

Alternative Names : Complex I-B14;CI-B14LYR motif-containing protein 6NADH-ubiquinone oxidoreductase B14 subunit

Expression Region : 27-154aa

AA Sequence : MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Function : Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families : Complex I LYR family

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : P56556