Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10)

Product Description

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) is available at Gentaur for Next week Delivery.

Gene Name: NDUFB10

Alternative Names : Complex I-PDSW

Expression Region : 1-172aa

AA Sequence : MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Function : Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families : Complex I NDUFB10 subunit family

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : O96000