Product Description
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7) is available at Gentaur for Next week Delivery.
Gene Name: NDUFB7
Alternative Names : Cell adhesion protein SQM1Complex I-B18;CI-B18NADH-ubiquinone oxidoreductase B18 subunit
Expression Region : 2-137aa
AA Sequence : GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 43.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Function : Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Involvement in disease :
Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein, Mitochondrion intermembrane space
Protein Families : Complex I NDUFB7 subunit family
Tissue Specificity :
Paythway : OxidativePhosphorylation
Uniprot ID : P17568
Euro
British Pound
US Dollar