Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial

Product Description

Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial is available at Gentaur for Next week Delivery.

Gene Name: NDUFV2

Alternative Names : NADH-ubiquinone oxidoreductase 24KDA subunit

Expression Region : 35-249aa

AA Sequence : GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 50.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone .

Function : Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Involvement in disease :

Subcellular location : Mitochondrion inner membrane

Protein Families : Complex I 24 kDa subunit family

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : P19404