Recombinant Human Neuritin (NRN1)

Product Description

Recombinant Human Neuritin (NRN1) is available at Gentaur for Next week Delivery.

Gene Name: NRN1

Alternative Names :

Expression Region : 28-116aa

AA Sequence : AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 25.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells.

Function : Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Cell junction, synapse

Protein Families : Neuritin family

Tissue Specificity :

Paythway :

Uniprot ID : Q9NPD7