Recombinant Human Neurotrophin-4 (NTF4), partial

Product Description

Recombinant Human Neurotrophin-4 (NTF4), partial is available at Gentaur for Next week Delivery.

Gene Name: NTF4

Alternative Names : Neurotrophin-5;NT-5Neutrophic factor 4

Expression Region : 82-210aa

AA Sequence : VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Target-derived survival factor for peripheral sensory sympathetic neurons.

Function : Target-derived survival factor for peripheral sensory sympathetic neurons.

Involvement in disease : Glaucoma 1, open angle, O (GLC1O)

Subcellular location : Secreted

Protein Families : NGF-beta family

Tissue Specificity : Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.

Paythway : MAPKsignalingpathway

Uniprot ID : P34130