Recombinant Human NHP2-like protein 1 (NHP2L1)

Product Description

Recombinant Human NHP2-like protein 1 (NHP2L1) is available at Gentaur for Next week Delivery.

Gene Name: NHP2L1

Alternative Names : High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog;hSNU13U4/U6.U5 tri-snRNP 15.5KDA protein

Expression Region : 2-128aa

AA Sequence : TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assbly. The protein undergoes a conformational change upon RNA-binding.

Function : Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Involvement in disease :

Subcellular location : Nucleus, nucleolus

Protein Families : Eukaryotic ribosomal protein eL8 family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : P55769