Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial

Product Description

Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT1), partial is available at Gentaur for Next week Delivery.

Gene Name: NAPRT1

Alternative Names : FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1

Expression Region : 229-538aa

AA Sequence : MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 60.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

Function : Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol

Protein Families : NAPRTase family

Tissue Specificity :

Paythway :

Uniprot ID : Q6XQN6