Recombinant Human NK-tumor recognition protein (NKTR), partial

Product Description

Recombinant Human NK-tumor recognition protein (NKTR), partial is available at Gentaur for Next week Delivery.

Gene Name: NKTR

Alternative Names : Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8);PPIase;Rotamase

Expression Region : 10-175aa

AA Sequence : HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of a putative tumor-recognition complex. Involved in the function of NK cells.

Function : Component of a putative tumor-recognition complex. Involved in the function of NK cells.

Involvement in disease :

Subcellular location : Membrane, Peripheral membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P30414