Recombinant Human Non-secretory ribonuclease (RNASE2)

Product Description

Recombinant Human Non-secretory ribonuclease (RNASE2) is available at Gentaur for Next week Delivery.

Gene Name: RNASE2

Alternative Names : Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2;RNase 2Ribonuclease US

Expression Region : 28-161aa

AA Sequence : KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.

Function : This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.

Involvement in disease :

Subcellular location : Lysosome, Cytoplasmic granule

Protein Families : Pancreatic ribonuclease family

Tissue Specificity : Liver, lung, spleen, leukocytes and body fluids.

Paythway :

Uniprot ID : P10153