Product Description
Recombinant Human Non-secretory ribonuclease (RNASE2) is available at Gentaur for Next week Delivery.
Gene Name: RNASE2
Alternative Names : Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2;RNase 2Ribonuclease US
Expression Region : 28-161aa
AA Sequence : KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 19.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Function : This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Involvement in disease :
Subcellular location : Lysosome, Cytoplasmic granule
Protein Families : Pancreatic ribonuclease family
Tissue Specificity : Liver, lung, spleen, leukocytes and body fluids.
Paythway :
Uniprot ID : P10153
Euro
British Pound
US Dollar