Recombinant Human Non-specific lipid-transfer protein (SCP2)

Product Description

Recombinant Human Non-specific lipid-transfer protein (SCP2) is available at Gentaur for Next week Delivery.

Gene Name: SCP2

Alternative Names : Propanoyl-CoA C-acyltransferase;SCP-chiSCPXSterol carrier protein 2;SCP-2Sterol carrier protein X;SCP-X

Expression Region : 1-143

AA Sequence : MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Sequence Info : Full Length of Isoform SCP2

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between mbranes. May play a role in regulating steroidogenesis.

Function : Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.

Involvement in disease : Leukoencephalopathy with dystonia and motor neuropathy (LKDMN)

Subcellular location : Cytoplasm, Mitochondrion, Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues, SUBCELLULAR LOCATION: Isoform SCPx: Peroxisome

Protein Families : Thiolase family

Tissue Specificity : Liver, fibroblasts, and placenta.

Paythway : PPARsignalingpathway

Uniprot ID : P22307