Product Description
Recombinant Human Non-specific lipid-transfer protein (SCP2) is available at Gentaur for Next week Delivery.
Gene Name: SCP2
Alternative Names : Propanoyl-CoA C-acyltransferase;SCP-chiSCPXSterol carrier protein 2;SCP-2Sterol carrier protein X;SCP-X
Expression Region : 1-143
AA Sequence : MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Sequence Info : Full Length of Isoform SCP2
Tag Info : N-terminal GST-tagged
Theoretical MW : 42.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between mbranes. May play a role in regulating steroidogenesis.
Function : Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Involvement in disease : Leukoencephalopathy with dystonia and motor neuropathy (LKDMN)
Subcellular location : Cytoplasm, Mitochondrion, Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues, SUBCELLULAR LOCATION: Isoform SCPx: Peroxisome
Protein Families : Thiolase family
Tissue Specificity : Liver, fibroblasts, and placenta.
Paythway : PPARsignalingpathway
Uniprot ID : P22307
Euro
British Pound
US Dollar