Recombinant Human Nucleolar protein 3 (NOL3)

Product Description

Recombinant Human Nucleolar protein 3 (NOL3) is available at Gentaur for Next week Delivery.

Gene Name: NOL3

Alternative Names : Apoptosis repressor with CARD1

Expression Region : 1-208aa

AA Sequence : MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Isoform 1: May be involved in RNA splicing.

Function : Isoform 1

Involvement in disease : Myoclonus, familial cortical (FCM)

Subcellular location : Isoform 1: Nucleus, nucleolus, Note=The SR-rich C-terminus mediates nuclear localization, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Mitochondrion, Sarcoplasmic reticulum, Membrane, Lipid-anchor

Protein Families :

Tissue Specificity : Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.

Paythway :

Uniprot ID : O60936