Recombinant Human Nucleoredoxin-like protein 2 (NXNL2)

Product Description

Recombinant Human Nucleoredoxin-like protein 2 (NXNL2) is available at Gentaur for Next week Delivery.

Gene Name: NXNL2

Alternative Names : Rod-derived cone viability factor 2;RdCVF2

Expression Region : 1-135aa

AA Sequence : MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.

Function : May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.

Involvement in disease :

Subcellular location :

Protein Families : Nucleoredoxin family

Tissue Specificity :

Paythway :

Uniprot ID : Q5VZ03