Recombinant Human Odorant-binding protein 2a (OBP2A)

Product Description

Recombinant Human Odorant-binding protein 2a (OBP2A) is available at Gentaur for Next week Delivery.

Gene Name: OBP2A

Alternative Names : Odorant-binding protein IIa Short name:OBPIIa

Expression Region : 16-170aa

AA Sequence : LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Function : Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calycin superfamily, Lipocalin family

Tissue Specificity : Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

Paythway :

Uniprot ID : Q9NY56