Product Description
Recombinant Human Odorant-binding protein 2a (OBP2A) is available at Gentaur for Next week Delivery.
Gene Name: OBP2A
Alternative Names : Odorant-binding protein IIa Short name:OBPIIa
Expression Region : 16-170aa
AA Sequence : LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 33.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.
Function : Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Calycin superfamily, Lipocalin family
Tissue Specificity : Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
Paythway :
Uniprot ID : Q9NY56
Euro
British Pound
US Dollar