Recombinant Human Orexin receptor type 1 (HCRTR1)

Product Description

Recombinant Human Orexin receptor type 1 (HCRTR1) is available at Gentaur for Next week Delivery.

Gene Name: HCRTR1

Alternative Names : Hypocretin receptor type 1

Expression Region : 1-46aa

AA Sequence : MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 21.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding

Function : Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity :

Paythway :

Uniprot ID : O43613