Recombinant Human Oxytocin-neurophysin 1 (OXT)

Product Description

Recombinant Human Oxytocin-neurophysin 1 (OXT) is available at Gentaur for Next week Delivery.

Gene Name: OXT

Alternative Names : Ocytocin

Expression Region : 20-125aa

AA Sequence : CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 26.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.

Function : Neurophysin 1 specifically binds oxytocin.; FUNCTION

Involvement in disease :

Subcellular location : Secreted

Protein Families : Vasopressin/oxytocin family

Tissue Specificity :

Paythway :

Uniprot ID : P01178