Product Description
Recombinant Human p53 and DNA damage-regulated protein 1 (PDRG1) is available at Gentaur for Next week Delivery.
Gene Name: PDRG1
Alternative Names :
Expression Region : 1-133aa
AA Sequence : MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 31.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in chaperone-mediated protein folding.Curated
Function : May play a role in chaperone-mediated protein folding.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Prefoldin subunit beta family
Tissue Specificity : Predominantly expressed in normal testis and exhibits reduced but detectable expression in other organs.
Paythway :
Uniprot ID : Q9NUG6
Euro
British Pound
US Dollar