Recombinant Human p53 and DNA damage-regulated protein 1 (PDRG1)

Product Description

Recombinant Human p53 and DNA damage-regulated protein 1 (PDRG1) is available at Gentaur for Next week Delivery.

Gene Name: PDRG1

Alternative Names :

Expression Region : 1-133aa

AA Sequence : MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 31.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in chaperone-mediated protein folding.Curated

Function : May play a role in chaperone-mediated protein folding.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Prefoldin subunit beta family

Tissue Specificity : Predominantly expressed in normal testis and exhibits reduced but detectable expression in other organs.

Paythway :

Uniprot ID : Q9NUG6