Recombinant Human p53 apoptosis effector related to PMP-22 (PERP)

Product Description

Recombinant Human p53 apoptosis effector related to PMP-22 (PERP) is available at Gentaur for Next week Delivery.

Gene Name: PERP

Alternative Names : Keratinocyte-associated protein 1

Expression Region : 1-193aa

AA Sequence : MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 41.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway

Function : Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).

Involvement in disease :

Subcellular location : Cell junction, desmosome, Cell membrane, Multi-pass membrane protein

Protein Families : TMEM47 family

Tissue Specificity : Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.

Paythway : p53signalingpathway

Uniprot ID : Q96FX8