Recombinant Human p53-regulated apoptosis-inducing protein 1 (TP53AIP1)

Product Description

Recombinant Human p53-regulated apoptosis-inducing protein 1 (TP53AIP1) is available at Gentaur for Next week Delivery.

Gene Name: TP53AIP1

Alternative Names :

Expression Region : 1-108aa

AA Sequence : MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

Sequence Info : Full Length of BC069399

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play an important role in mediating p53/TP53-dependent apoptosis.

Function : May play an important role in mediating p53/TP53-dependent apoptosis.

Involvement in disease :

Subcellular location : Mitochondrion

Protein Families :

Tissue Specificity : Only found to be expressed in thymus.

Paythway : p53signalingpathway

Uniprot ID : Q9HCN2