Recombinant Human Paralemmin-1 (PALM)

Product Description

Recombinant Human Paralemmin-1 (PALM) is available at Gentaur for Next week Delivery.

Gene Name: PALM

Alternative Names : Paralemmin

Expression Region : 1-384aa

AA Sequence : MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 45.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.

Function : Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, axon, Cell projection, dendrite, Cell projection, dendritic spine, Basolateral cell membrane, Lipid-anchor, Apicolateral cell membrane, Lipid-anchor

Protein Families : Paralemmin family

Tissue Specificity : Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland.

Paythway :

Uniprot ID : O75781