Product Description
Recombinant Human Paralemmin-1 (PALM) is available at Gentaur for Next week Delivery.
Gene Name: PALM
Alternative Names : Paralemmin
Expression Region : 1-384aa
AA Sequence : MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 45.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Function : Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, axon, Cell projection, dendrite, Cell projection, dendritic spine, Basolateral cell membrane, Lipid-anchor, Apicolateral cell membrane, Lipid-anchor
Protein Families : Paralemmin family
Tissue Specificity : Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland.
Paythway :
Uniprot ID : O75781
Euro
British Pound
US Dollar