Product Description
Recombinant Human PCNA-associated factor (PCLAF) is available at Gentaur for Next week Delivery.
Gene Name: PCLAF
Alternative Names : Hepatitis C virus NS5A-transactivated protein 9;HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1;OEATC-1;PCNA-associated factor of 15KDA;PAF15;p15PAF
Expression Region : 1-111aa
AA Sequence : MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Function : PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Involvement in disease :
Subcellular location : Nucleus, Cytoplasm, perinuclear region
Protein Families :
Tissue Specificity : Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas, adrenocortical carcinomas, and in non-small-cell lung cancer lines.
Paythway : InflammatoryPain
Uniprot ID : Q15004
Euro
British Pound
US Dollar